Brand: | Abnova |
Reference: | H00008795-M01 |
Product name: | TNFRSF10B monoclonal antibody (M01), clone 2D6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TNFRSF10B. |
Clone: | 2D6 |
Isotype: | IgG1 Kappa |
Gene id: | 8795 |
Gene name: | TNFRSF10B |
Gene alias: | CD262|DR5|KILLER|KILLER/DR5|TRAIL-R2|TRAILR2|TRICK2|TRICK2A|TRICK2B|TRICKB|ZTNFR9 |
Gene description: | tumor necrosis factor receptor superfamily, member 10b |
Genbank accession: | BC001281 |
Immunogen: | TNFRSF10B (AAH01281, 71 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | QKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDC |
Protein accession: | AAH01281 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged TNFRSF10B is approximately 1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,IP |
Shipping condition: | Dry Ice |