Brand: | Abnova |
Reference: | H00008795-H02 |
Product name: | TNFRSF10B (Human) Recombinant Protein |
Product description: | Purified TNFRSF10B (AAH01281.1 56 a.a. - 180 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells. |
Gene id: | 8795 |
Gene name: | TNFRSF10B |
Gene alias: | CD262|DR5|KILLER|KILLER/DR5|TRAIL-R2|TRAILR2|TRICK2|TRICK2A|TRICK2B|TRICKB|ZTNFR9 |
Gene description: | tumor necrosis factor receptor superfamily, member 10b |
Genbank accession: | BC001281.1 |
Immunogen sequence/protein sequence: | ITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVH |
Protein accession: | AAH01281.1 |
Form: | Liquid |
Concentration: | ⥠10 ug/ml |
Host cell: | Human HEK293T cells |
Preparation method: | Transfection of pSuper-TNFRSF10B plasmid into HEK293T cell, and the expressed protein was purified by Strep-Tactin affinity column. |
Storage buffer: | 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin. |
Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | SDS-PAGE and Western Blot |
Quality control testing picture: |  |
Tag: | His-Flag-StrepII |
Product type: | Proteins |
Host species: | Human |
Antigen species / target species: | Human |
Applications: | WB,ELISA,SDS-PAGE,PI |
Shipping condition: | Dry Ice |