Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00008794-B01 |
Product name: | TNFRSF10C MaxPab mouse polyclonal antibody (B01) |
Product description: | Mouse polyclonal antibody raised against a full-length human TNFRSF10C protein. |
Gene id: | 8794 |
Gene name: | TNFRSF10C |
Gene alias: | CD263|DCR1|LIT|MGC149501|MGC149502|TRAILR3|TRID |
Gene description: | tumor necrosis factor receptor superfamily, member 10c, decoy without an intracellular domain |
Genbank accession: | NM_003841 |
Immunogen: | TNFRSF10C (NP_003832, 1 a.a. ~ 259 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MARIPKTLKFVVVIVAVLLPVLAYSATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPASSHYLSCTIVGIIVLIVLLIVFV |
Protein accession: | NP_003832 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of TNFRSF10C expression in transfected 293T cell line (H00008794-T01) by TNFRSF10C MaxPab polyclonal antibody. Lane 1: TNFRSF10C transfected lysate(28.49 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |