Brand: | Abnova |
Reference: | H00008793-A01 |
Product name: | TNFRSF10D polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant TNFRSF10D. |
Gene id: | 8793 |
Gene name: | TNFRSF10D |
Gene alias: | CD264|DCR2|TRAILR4|TRUNDD |
Gene description: | tumor necrosis factor receptor superfamily, member 10d, decoy with truncated death domain |
Genbank accession: | NM_003840 |
Immunogen: | TNFRSF10D (NP_003831, 56 a.a. ~ 145 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | ATIPRQDEVPQQTVAPQQQRRSLKEEECPAGSHRSEYTGACNPCTEGVDYTIASNNLPSCLLCTVCKSGQTNKSSCTTTRDTVCQCEKGS |
Protein accession: | NP_003831 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |