Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TNFRSF18 monoclonal antibody (M03), clone 2H4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about TNFRSF18 monoclonal antibody (M03), clone 2H4
| Brand: | Abnova |
| Reference: | H00008784-M03 |
| Product name: | TNFRSF18 monoclonal antibody (M03), clone 2H4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TNFRSF18. |
| Clone: | 2H4 |
| Isotype: | IgG2b Kappa |
| Gene id: | 8784 |
| Gene name: | TNFRSF18 |
| Gene alias: | AITR|GITR|GITR-D |
| Gene description: | tumor necrosis factor receptor superfamily, member 18 |
| Genbank accession: | NM_004195 |
| Immunogen: | TNFRSF18 (NP_004186, 26 a.a. ~ 115 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | QRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRDYPGEECCSEWDCMCVQPEFHCGDPCCTTCRHHPCPPGQGVQSQGKFSFGFQCIDC |
| Protein accession: | NP_004186 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | TNFRSF18 monoclonal antibody (M03), clone 2H4. Western Blot analysis of TNFRSF18 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |