RIOK3 monoclonal antibody (M02), clone 3G11 View larger

RIOK3 monoclonal antibody (M02), clone 3G11

H00008780-M02_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RIOK3 monoclonal antibody (M02), clone 3G11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab

More info about RIOK3 monoclonal antibody (M02), clone 3G11

Brand: Abnova
Reference: H00008780-M02
Product name: RIOK3 monoclonal antibody (M02), clone 3G11
Product description: Mouse monoclonal antibody raised against a partial recombinant RIOK3.
Clone: 3G11
Isotype: IgG1 Kappa
Gene id: 8780
Gene name: RIOK3
Gene alias: DKFZp779L1370|SUDD
Gene description: RIO kinase 3 (yeast)
Genbank accession: BC039729
Immunogen: RIOK3 (AAH39729, 411 a.a. ~ 516 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: NMLWHAGKVWLIDVSQSVEPTHPHGLEFLFRDCRNVSQKGGVKEALSERELFNAVSGLNITADNEADFLAEIEALEKMNEDHVQKNGRKAASFLKDDGDPPLLYDE
Protein accession: AAH39729
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008780-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.29 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008780-M02-1-9-1.jpg
Application image note: RIOK3 monoclonal antibody (M02), clone 3G11 Western Blot analysis of RIOK3 expression in K-562 ( Cat # L009V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab
Shipping condition: Dry Ice

Reviews

Buy RIOK3 monoclonal antibody (M02), clone 3G11 now

Add to cart