NAPG monoclonal antibody (M03), clone 4B5 View larger

NAPG monoclonal antibody (M03), clone 4B5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NAPG monoclonal antibody (M03), clone 4B5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about NAPG monoclonal antibody (M03), clone 4B5

Brand: Abnova
Reference: H00008774-M03
Product name: NAPG monoclonal antibody (M03), clone 4B5
Product description: Mouse monoclonal antibody raised against a partial recombinant NAPG.
Clone: 4B5
Isotype: IgG1 Kappa
Gene id: 8774
Gene name: NAPG
Gene alias: GAMMASNAP
Gene description: N-ethylmaleimide-sensitive factor attachment protein, gamma
Genbank accession: NM_003826
Immunogen: NAPG (NP_003817.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAAQKINEGLEHLAKAEKYLKTGFLKWKPDYDSAASEYGKAAVAFKNAKQFEQAKDACLREAVAHENNRALFHAAKAYEQAGMMLKEMQKLPEAVQLIEK
Protein accession: NP_003817.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008774-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008774-M03-1-12-1.jpg
Application image note: NAPG monoclonal antibody (M03), clone 4B5. Western Blot analysis of NAPG expression in HepG2(Cat # L019V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy NAPG monoclonal antibody (M03), clone 4B5 now

Add to cart