Brand: | Abnova |
Reference: | H00008772-M03 |
Product name: | FADD monoclonal antibody (M03), clone 1D5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant FADD. |
Clone: | 1D5 |
Isotype: | IgG1 Lambda |
Gene id: | 8772 |
Gene name: | FADD |
Gene alias: | GIG3|MGC8528|MORT1 |
Gene description: | Fas (TNFRSF6)-associated via death domain |
Genbank accession: | BC000334 |
Immunogen: | FADD (AAH00334, 109 a.a. ~ 208 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS |
Protein accession: | AAH00334 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged FADD is approximately 0.03ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |