FADD monoclonal antibody (M03), clone 1D5 View larger

FADD monoclonal antibody (M03), clone 1D5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FADD monoclonal antibody (M03), clone 1D5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about FADD monoclonal antibody (M03), clone 1D5

Brand: Abnova
Reference: H00008772-M03
Product name: FADD monoclonal antibody (M03), clone 1D5
Product description: Mouse monoclonal antibody raised against a partial recombinant FADD.
Clone: 1D5
Isotype: IgG1 Lambda
Gene id: 8772
Gene name: FADD
Gene alias: GIG3|MGC8528|MORT1
Gene description: Fas (TNFRSF6)-associated via death domain
Genbank accession: BC000334
Immunogen: FADD (AAH00334, 109 a.a. ~ 208 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS
Protein accession: AAH00334
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008772-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008772-M03-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged FADD is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FADD monoclonal antibody (M03), clone 1D5 now

Add to cart