Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of FADD purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ti,WB-Tr,PLA-Ce |
More info about FADD purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00008772-D01P |
| Product name: | FADD purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human FADD protein. |
| Gene id: | 8772 |
| Gene name: | FADD |
| Gene alias: | GIG3|MGC8528|MORT1 |
| Gene description: | Fas (TNFRSF6)-associated via death domain |
| Genbank accession: | NM_003824 |
| Immunogen: | FADD (NP_003815.1, 1 a.a. ~ 208 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS |
| Protein accession: | NP_003815.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of FADD expression in transfected 293T cell line (H00008772-T01) by FADD MaxPab polyclonal antibody. Lane 1: FADD transfected lysate(23.30 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ti,WB-Tr,PLA-Ce |
| Shipping condition: | Dry Ice |