Brand: | Abnova |
Reference: | H00008767-M03 |
Product name: | RIPK2 monoclonal antibody (M03), clone 3D9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RIPK2. |
Clone: | 3D9 |
Isotype: | IgG2a Kappa |
Gene id: | 8767 |
Gene name: | RIPK2 |
Gene alias: | CARD3|CARDIAK|CCK|GIG30|RICK|RIP2 |
Gene description: | receptor-interacting serine-threonine kinase 2 |
Genbank accession: | BC004553 |
Immunogen: | RIPK2 (AAH04553, 431 a.a. ~ 540 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LQPGIAQQWIQSKREDIVNQMTEACLNQSLDALLSRDLIMKEDYELVSTKPTRTSKVRQLLDTTDIQGEEFAKVIVQKLKDNKQMGLQPYPEILVVSRSPSLNLLQNKSM |
Protein accession: | AAH04553 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: |  |
Application image note: | RIPK2 monoclonal antibody (M03), clone 3D9 Western Blot analysis of RIPK2 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |