View larger

TNFRSF14 purified MaxPab mouse polyclonal antibody (B01P)

Reference:

Condition: New product

Data sheet of TNFRSF14 purified MaxPab mouse polyclonal antibody (B01P)

Brand	Abnova
Product type	Primary antibodies
Reactivity	Human
Host species	Mouse
Applications	WB-Ce,WB-Tr

More info about TNFRSF14 purified MaxPab mouse polyclonal antibody (B01P)

Brand:	Abnova
Reference:	H00008764-B01P
Product name:	TNFRSF14 purified MaxPab mouse polyclonal antibody (B01P)
Product description:	Mouse polyclonal antibody raised against a full-length human TNFRSF14 protein.
Gene id:	8764
Gene name:	TNFRSF14
Gene alias:	ATAR\|HVEA\|HVEM\|LIGHTR\|TR2
Gene description:	tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator)
Genbank accession:	NM_003820
Immunogen:	TNFRSF14 (NP_003811.2, 1 a.a. ~ 283 a.a) full-length human protein.
Immunogen sequence/protein sequence:	MEPPGDWGPPPWRSTPKTDVLRLVLYLTFLGAPCYAPALPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCSWLVTKAGAGTSSSHWVWWFLSGSLVIVIVCSTVGLIICVKRRKPRGDVVKVIVSVQRKRQEAEGEATVIEALQAPPDVTTVAVEETIPSFTGRSPNH
Protein accession:	NP_003811.2
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody reactive against mammalian transfected lysate.
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Western Blot analysis of TNFRSF14 expression in transfected 293T cell line (H00008764-T01) by TNFRSF14 MaxPab polyclonal antibody. Lane 1: TNFRSF14 transfected lysate(31.13 KDa). Lane 2: Non-transfected lysate.
Applications:	WB-Ce,WB-Tr
Shipping condition:	Dry Ice

Reviews

Be the first to write your review !

Buy TNFRSF14 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart