ADAM9 monoclonal antibody (M01), clone 3E6 View larger

ADAM9 monoclonal antibody (M01), clone 3E6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ADAM9 monoclonal antibody (M01), clone 3E6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about ADAM9 monoclonal antibody (M01), clone 3E6

Brand: Abnova
Reference: H00008754-M01
Product name: ADAM9 monoclonal antibody (M01), clone 3E6
Product description: Mouse monoclonal antibody raised against a partial recombinant ADAM9.
Clone: 3E6
Isotype: IgG1 Kappa
Gene id: 8754
Gene name: ADAM9
Gene alias: KIAA0021|MCMP|MDC9|Mltng
Gene description: ADAM metallopeptidase domain 9 (meltrin gamma)
Genbank accession: NM_003816
Immunogen: ADAM9 (NP_003807, 36 a.a. ~ 135 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QTSHLSSYEIITPWRLTRERREAPRPYSKQVSYVIQAEGKEHIIHLERNKDLLPEDFVVYTYNKEGTLITDHPNIQNHCHYRGYVEGVHNSSIALSDCFG
Protein accession: NP_003807
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008754-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008754-M01-1-4-1.jpg
Application image note: ADAM9 monoclonal antibody (M01), clone 3E6 Western Blot analysis of ADAM9 expression in A-431 ( Cat # L015V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ADAM9 monoclonal antibody (M01), clone 3E6 now

Add to cart