Brand: | Abnova |
Reference: | H00008748-M05 |
Product name: | ADAM20 monoclonal antibody (M05), clone 4B10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ADAM20. |
Clone: | 4B10 |
Isotype: | IgG2b Kappa |
Gene id: | 8748 |
Gene name: | ADAM20 |
Gene alias: | - |
Gene description: | ADAM metallopeptidase domain 20 |
Genbank accession: | NM_003814 |
Immunogen: | ADAM20 (NP_003805, 268 a.a. ~ 358 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | IRYLFSQSNATTVQHEVFNVVNIVDSFYHPLEVDVILTGIDIWTASNPLPTSGDLDNVLEDFSIWKNYNLNNRLQHDVAHLFIKDTQGMKL |
Protein accession: | NP_003805 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | |
Quality control testing picture note: | Western Blot detection against Immunogen (35.75 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | |
Application image note: | Detection limit for recombinant GST tagged ADAM20 is approximately 1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |