Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00008744-M01 |
Product name: | TNFSF9 monoclonal antibody (M01), clone 1D7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TNFSF9. |
Clone: | 1D7 |
Isotype: | IgG2a Kappa |
Gene id: | 8744 |
Gene name: | TNFSF9 |
Gene alias: | 4-1BB-L|CD137L |
Gene description: | tumor necrosis factor (ligand) superfamily, member 9 |
Genbank accession: | NM_003811 |
Immunogen: | TNFSF9 (NP_003802, 145 a.a. ~ 254 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | FQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE |
Protein accession: | NP_003802 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of TNFSF9 expression in transfected 293T cell line by TNFSF9 monoclonal antibody (M01), clone 1D7. Lane 1: TNFSF9 transfected lysate (Predicted MW: 27.94 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |