Brand: | Abnova |
Reference: | H00008744-H01 |
Product name: | TNFSF9 (Human) Recombinant Protein |
Product description: | Purified TNFSF9 (AAI04806.1 50 a.a. - 254 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells. |
Gene id: | 8744 |
Gene name: | TNFSF9 |
Gene alias: | 4-1BB-L|CD137L |
Gene description: | tumor necrosis factor (ligand) superfamily, member 9 |
Genbank accession: | BC104805.1 |
Immunogen sequence/protein sequence: | ACPWAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE |
Protein accession: | AAI04806.1 |
Form: | Liquid |
Concentration: | ⥠10 ug/ml |
Host cell: | Human HEK293T cells |
Preparation method: | Transfection of pSuper-TNFSF9 plasmid into HEK293T cell, and the expressed protein was purified by Strep-Tactin affinity column. |
Storage buffer: | 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin. |
Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | SDS-PAGE and Western Blot |
Quality control testing picture: |  |
Tag: | His-Flag-StrepII |
Product type: | Proteins |
Host species: | Human |
Antigen species / target species: | Human |
Applications: | WB,ELISA,SDS-PAGE,PI |
Shipping condition: | Dry Ice |