TNFSF12 purified MaxPab mouse polyclonal antibody (B01P) View larger

TNFSF12 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TNFSF12 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about TNFSF12 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00008742-B01P
Product name: TNFSF12 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human TNFSF12 protein.
Gene id: 8742
Gene name: TNFSF12
Gene alias: APO3L|DR3LG|MGC129581|MGC20669|TWEAK
Gene description: tumor necrosis factor (ligand) superfamily, member 12
Genbank accession: BC071837
Immunogen: TNFSF12 (AAH71837.1, 1 a.a. ~ 134 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAARRSQRRRGRRGEPGTALLVPLALGLGLALACLGLLLAVVSLGSRASLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQADGGYTTCLRP
Protein accession: AAH71837.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008742-B01P-13-15-1.jpg
Application image note: Western Blot analysis of TNFSF12 expression in transfected 293T cell line (H00008742-T01) by TNFSF12 MaxPab polyclonal antibody.

Lane 1: TNFSF12 transfected lysate(14.74 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy TNFSF12 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart