Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00008740-M01A |
Product name: | TNFSF14 monoclonal antibody (M01A), clone 4E3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TNFSF14. |
Clone: | 4E3 |
Isotype: | IgG2a Kappa |
Gene id: | 8740 |
Gene name: | TNFSF14 |
Gene alias: | CD258|HVEML|LIGHT|LTg|TR2 |
Gene description: | tumor necrosis factor (ligand) superfamily, member 14 |
Genbank accession: | BC018058 |
Immunogen: | TNFSF14 (AAH18058, 61 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LHWRLGEMVTRLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGVAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRT |
Protein accession: | AAH18058 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of TNFSF14 expression in transfected 293T cell line by TNFSF14 monoclonal antibody (M01A), clone 4E3. Lane 1: TNFSF14 transfected lysate(22.4 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |