TNFSF14 purified MaxPab mouse polyclonal antibody (B02P) View larger

TNFSF14 purified MaxPab mouse polyclonal antibody (B02P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TNFSF14 purified MaxPab mouse polyclonal antibody (B02P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about TNFSF14 purified MaxPab mouse polyclonal antibody (B02P)

Brand: Abnova
Reference: H00008740-B02P
Product name: TNFSF14 purified MaxPab mouse polyclonal antibody (B02P)
Product description: Mouse polyclonal antibody raised against a full-length human TNFSF14 protein.
Gene id: 8740
Gene name: TNFSF14
Gene alias: CD258|HVEML|LIGHT|LTg|TR2
Gene description: tumor necrosis factor (ligand) superfamily, member 14
Genbank accession: NM_172014
Immunogen: TNFSF14 (NP_742011.1, 1 a.a. ~ 204 a.a) full-length human protein.
Immunogen sequence/protein sequence: MEESVVRPSVFVVDGQTDIPFTRLGRSHRRQSCSVARDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEEVVVRVLDERLVRLRDGTRSYFGAFMV
Protein accession: NP_742011.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008740-B02P-13-15-1.jpg
Application image note: Western Blot analysis of TNFSF14 expression in transfected 293T cell line (H00008740-T03) by TNFSF14 MaxPab polyclonal antibody.

Lane 1: TNFSF14 transfected lysate(22.40 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy TNFSF14 purified MaxPab mouse polyclonal antibody (B02P) now

Add to cart