CRADD (Human) Recombinant Protein (P02) View larger

CRADD (Human) Recombinant Protein (P02)

New product

374,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CRADD (Human) Recombinant Protein (P02)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about CRADD (Human) Recombinant Protein (P02)

Brand: Abnova
Reference: H00008738-P02
Product name: CRADD (Human) Recombinant Protein (P02)
Product description: Human CRADD full-length ORF ( AAH17042, 1 a.a. - 199 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 8738
Gene name: CRADD
Gene alias: MGC9163|RAIDD
Gene description: CASP2 and RIPK1 domain containing adaptor with death domain
Genbank accession: BC017042
Immunogen sequence/protein sequence: MEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHIQEINAQTTGLRKTMLLLDILPSRGPKAFDTFLDSLQEFPWVREKLKKAREEAMTDLPAGDRLTGIPSHILNSSPSDRQINQLAQRLGPEWEPMVPSLGLSQTDIYRCKANHPHNVQSQVVEAFIRWRQRFGKQATFQSLHNGLRAVEVDPSLLLHMLE
Protein accession: AAH17042
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00008738-P02-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CRADD (Human) Recombinant Protein (P02) now

Add to cart