Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of C19orf2 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about C19orf2 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00008725-A01 |
| Product name: | C19orf2 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant C19orf2. |
| Gene id: | 8725 |
| Gene name: | C19orf2 |
| Gene alias: | FLJ10575|NNX3|RMP|URI |
| Gene description: | chromosome 19 open reading frame 2 |
| Genbank accession: | NM_003796 |
| Immunogen: | C19orf2 (NP_003787, 371 a.a. ~ 475 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | NSTGSGHSAQELPTIRTPADIYRAFVDVVNGEYVPRKSILKSRSRENSVCSDTSESSAAEFDDRRGVLRSISCEEATCSDTSESILEEEPQENQKKLLPLSVTPE |
| Protein accession: | NP_003787 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.66 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Regulation of Androgen Receptor-Mediated Transcription by RPB5 Binding Protein URI/RMP.Mita P, Savas JN, Djouder N, Yates JR 3rd, Ha S, Ruoff R, Schafler ED, Nwachukwu JC, Tanese N, Cowan NJ, Zavadil J, Garabedian MJ, Logan SK. Mol Cell Biol. 2011 Sep;31(17):3639-52. Epub 2011 Jul 5. |