Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SNX4 monoclonal antibody (M01), clone 4H8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about SNX4 monoclonal antibody (M01), clone 4H8
| Brand: | Abnova |
| Reference: | H00008723-M01 |
| Product name: | SNX4 monoclonal antibody (M01), clone 4H8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SNX4. |
| Clone: | 4H8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 8723 |
| Gene name: | SNX4 |
| Gene alias: | - |
| Gene description: | sorting nexin 4 |
| Genbank accession: | BC018762 |
| Immunogen: | SNX4 (AAH18762, 341 a.a. ~ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | QCEELVTGTVRTFSLKGMTTKLFGQETPEQREARIKVLEEQINEGEQQLKSKNLEGREFVKNAWADIERFKEQKNRDLKEALISYAVMQISMCKKGIQVWTNAKECFSKM |
| Protein accession: | AAH18762 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | SNX4 monoclonal antibody (M01), clone 4H8 Western Blot analysis of SNX4 expression in A-431 ( Cat # L015V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | SNX4 coordinates endosomal sorting of TfnR with dynein-mediated transport into the endocytic recycling compartment.Traer CJ, Rutherford AC, Palmer KJ, Wassmer T, Oakley J, Attar N, Carlton JG, Kremerskothen J, Stephens DJ, Cullen PJ. Nat Cell Biol. 2007 Dec;9(12):1370-80. Epub 2007 Nov 11. |