Brand: | Abnova |
Reference: | H00008721-M03 |
Product name: | EDF1 monoclonal antibody (M03), clone 3E6 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant EDF1. |
Clone: | 3E6 |
Isotype: | IgG2a Kappa |
Gene id: | 8721 |
Gene name: | EDF1 |
Gene alias: | EDF-1|MBF1|MGC9058 |
Gene description: | endothelial differentiation-related factor 1 |
Genbank accession: | BC015500 |
Immunogen: | EDF1 (AAH15500.1, 1 a.a. ~ 148 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQSRGEDVETSKKWAAGQNKQHSITKNTAKLDRETEELHHDRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIEKGPRAK |
Protein accession: | AAH15500.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (42.02 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | EDF1 monoclonal antibody (M03), clone 3E6. Western Blot analysis of EDF1 expression in Hela S3 NE(Cat # L013V3 ). |
Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |