Brand: | Abnova |
Reference: | H00008720-M07 |
Product name: | MBTPS1 monoclonal antibody (M07), clone 2E6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MBTPS1. |
Clone: | 2E6 |
Isotype: | IgG1 Kappa |
Gene id: | 8720 |
Gene name: | MBTPS1 |
Gene alias: | KIAA0091|MGC138711|MGC138712|PCSK8|S1P|SKI-1 |
Gene description: | membrane-bound transcription factor peptidase, site 1 |
Genbank accession: | NM_201268 |
Immunogen: | MBTPS1 (NP_957720.1, 246 a.a. ~ 355 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GLGHGTFVAGVIASMRECQGFAPDAELHIFRVFTNNQVSYTSWFLDAFNYAILKKIDVLNLSIGGPDFMDHPFVDKVWELTANNVIMVSAIGNDGPLYGTLNNPADQMDV |
Protein accession: | NP_957720.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged MBTPS1 is 0.1 ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA |
Shipping condition: | Dry Ice |