Brand: | Abnova |
Reference: | H00008715-M01 |
Product name: | NOL4 monoclonal antibody (M01), clone 2A10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NOL4. |
Clone: | 2A10 |
Isotype: | IgG2a Kappa |
Gene id: | 8715 |
Gene name: | NOL4 |
Gene alias: | HRIHFB2255|NOLP |
Gene description: | nucleolar protein 4 |
Genbank accession: | NM_003787 |
Immunogen: | NOL4 (NP_003778, 425 a.a. ~ 524 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PGSQDVLYINGNGTYSYHSYRGLGGGLLNLNDASSSGPTDLSMKRQLATSSGSSSSSNSRPQLSPTEINAVRQLVAGYRESAAFLLRSADELENLILQQN |
Protein accession: | NP_003778 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | |
Application image note: | Immunoperoxidase of monoclonal antibody to NOL4 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml] |
Applications: | IHC-P,IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |