B3GALT2 monoclonal antibody (M02), clone 3A6 View larger

B3GALT2 monoclonal antibody (M02), clone 3A6

H00008707-M02_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of B3GALT2 monoclonal antibody (M02), clone 3A6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about B3GALT2 monoclonal antibody (M02), clone 3A6

Brand: Abnova
Reference: H00008707-M02
Product name: B3GALT2 monoclonal antibody (M02), clone 3A6
Product description: Mouse monoclonal antibody raised against a partial recombinant B3GALT2.
Clone: 3A6
Isotype: IgG2a Kappa
Gene id: 8707
Gene name: B3GALT2
Gene alias: BETA3GALT2|GLCT2|beta3Gal-T2
Gene description: UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 2
Genbank accession: NM_003783
Immunogen: B3GALT2 (NP_003774, 324 a.a. ~ 422 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: AEKIFKVSLGIRRLHLEDVYVGICLAKLRIDPVPPPNEFVFNHWRVSYSSCKYSHLITSHQFQPSELIKYWNHLQQNKHNACANAAKEKAGRYRHRKLH
Protein accession: NP_003774
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008707-M02-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged B3GALT2 is approximately 3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy B3GALT2 monoclonal antibody (M02), clone 3A6 now

Add to cart