Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of B4GALT4 monoclonal antibody (M01), clone 5E2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
More info about B4GALT4 monoclonal antibody (M01), clone 5E2
| Brand: | Abnova |
| Reference: | H00008702-M01 |
| Product name: | B4GALT4 monoclonal antibody (M01), clone 5E2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant B4GALT4. |
| Clone: | 5E2 |
| Isotype: | IgG1 Kappa |
| Gene id: | 8702 |
| Gene name: | B4GALT4 |
| Gene alias: | B4Gal-T4|beta4Gal-T4 |
| Gene description: | UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 4 |
| Genbank accession: | NM_003778 |
| Immunogen: | B4GALT4 (NP_003769, 35 a.a. ~ 134 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VGAIQEIPKAKEFMANFHKTLILGKGKTLTNEASTKKVELDNCPSVSPYLRGQSKLIFKPDLTLEEVQAENPKVSRGRYRPQECKALQRVAILVPHRNRE |
| Protein accession: | NP_003769 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western blot analysis of B4GALT4 over-expressed 293 cell line, cotransfected with B4GALT4 Validated Chimera RNAi ( Cat # H00008702-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with B4GALT4 monoclonal antibody (M01), clone 5E2 (Cat # H00008702-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |