Brand: | Abnova |
Reference: | H00008683-M01 |
Product name: | SFRS9 monoclonal antibody (M01), clone 1G7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SFRS9. |
Clone: | 1G7 |
Isotype: | IgG2a Kappa |
Gene id: | 8683 |
Gene name: | SFRS9 |
Gene alias: | SRp30c |
Gene description: | splicing factor, arginine/serine-rich 9 |
Genbank accession: | NM_003769 |
Immunogen: | SFRS9 (NP_003760.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSGWADERGGEGDGRIYVGNLPTDVREKDLEDLFYKYGRIREIELKNRHGLVPFAFVRFEDPRDAEDAIYGRNGYDYGQCRLRVEFPRTYGGRGGWPRGG |
Protein accession: | NP_003760.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: |  |
Application image note: | SFRS9 monoclonal antibody (M01), clone 1G7. Western Blot analysis of SFRS9 expression in Raw 264.7(Cat # L024V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |