SFRS9 MaxPab mouse polyclonal antibody (B03) View larger

SFRS9 MaxPab mouse polyclonal antibody (B03)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SFRS9 MaxPab mouse polyclonal antibody (B03)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about SFRS9 MaxPab mouse polyclonal antibody (B03)

Brand: Abnova
Reference: H00008683-B03
Product name: SFRS9 MaxPab mouse polyclonal antibody (B03)
Product description: Mouse polyclonal antibody raised against a full-length human SFRS9 protein.
Gene id: 8683
Gene name: SFRS9
Gene alias: SRp30c
Gene description: splicing factor, arginine/serine-rich 9
Genbank accession: NM_003769
Immunogen: SFRS9 (NP_003760.1, 1 a.a. ~ 221 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSGWADERGGEGDGRIYVGNLPTDVREKDLEDLFYKYGRIREIELKNRHGLVPFAFVRFEDPRDAEDAIYGRNGYDYGQCRLRVEFPRTYGGRGGWPRGGRNGPPTRRSDFRVLVSGLPPSGSWQDLKDHMREAGDVCYADVQKDGVGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYIRVYPERSTSYGYSRSRSGSRGRDSPYQSRGSPHYFSPFRPY
Protein accession: NP_003760.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008683-B03-13-15-1.jpg
Application image note: Western Blot analysis of SFRS9 expression in transfected 293T cell line (H00008683-T01) by SFRS9 MaxPab polyclonal antibody.

Lane 1: SFRS9 transfected lysate(24.31 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SFRS9 MaxPab mouse polyclonal antibody (B03) now

Add to cart