Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SLC4A4 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about SLC4A4 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00008671-A01 |
| Product name: | SLC4A4 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant SLC4A4. |
| Gene id: | 8671 |
| Gene name: | SLC4A4 |
| Gene alias: | DKFZp781H1314|HNBC1|KNBC|NBC1|NBC2|SLC4A5|hhNMC|pNBC |
| Gene description: | solute carrier family 4, sodium bicarbonate cotransporter, member 4 |
| Genbank accession: | NM_003759 |
| Immunogen: | SLC4A4 (NP_003750, 121 a.a. ~ 229 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MEKGSIMLDREASSLPQLVEMIVDHQIETGLLKPELKDKVTYTLLRKHRHQTKKSNLRSLADIGKTVSSASRMFTNPDNGSPAMTHRNLTSSSLNDISDKPEKDQLKNK |
| Protein accession: | NP_003750 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.1 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | AHCYL2 (long-IRBIT) as a potential regulator of the electrogenic Na+-HCO3- cotransporter NBCe1-B.Yamaguchi S, Ishikawa T FEBS Lett. 2014 Jan 25. pii: S0014-5793(14)00051-9. doi: 10.1016/j.febslet.2013.12.036. |