Brand: | Abnova |
Reference: | H00008665-A01 |
Product name: | EIF3S5 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant EIF3S5. |
Gene id: | 8665 |
Gene name: | EIF3F |
Gene alias: | EIF3S5|eIF3-p47 |
Gene description: | eukaryotic translation initiation factor 3, subunit F |
Genbank accession: | NM_003754 |
Immunogen: | EIF3S5 (NP_003745, 258 a.a. ~ 357 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | SPNRVIGLSSDLQQVGGASARIQDALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDFETMLNSNINDLLMVTYLANLTQSQIALNEKLVNL |
Protein accession: | NP_003745 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: |  |
Application image note: | EIF3S5 polyclonal antibody (A01), Lot # 070109QCSb Western Blot analysis of EIF3S5 expression in PC-12 ( Cat # L012V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |