Brand: | Abnova |
Reference: | H00008655-M02 |
Product name: | DYNLL1 monoclonal antibody (M02), clone 1H7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DYNLL1. |
Clone: | 1H7 |
Isotype: | IgG2a Kappa |
Gene id: | 8655 |
Gene name: | DYNLL1 |
Gene alias: | DLC1|DLC8|DNCL1|DNCLC1|LC8|LC8a|MGC126137|MGC126138|PIN|hdlc1 |
Gene description: | dynein, light chain, LC8-type 1 |
Genbank accession: | NM_003746 |
Immunogen: | DYNLL1 (NP_003737.1, 1 a.a. ~ 72 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKH |
Protein accession: | NP_003737.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.66 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged DYNLL1 is 0.1 ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |