Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PDE5A polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about PDE5A polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00008654-A01 |
| Product name: | PDE5A polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant PDE5A. |
| Gene id: | 8654 |
| Gene name: | PDE5A |
| Gene alias: | CGB-PDE|CN5A|PDE5|PDE5A1 |
| Gene description: | phosphodiesterase 5A, cGMP-specific |
| Genbank accession: | NM_001083 |
| Immunogen: | PDE5A (NP_001074, 29 a.a. ~ 138 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | SVEAWLDDHWDFTFSYFVRKATREMVNAWFAERVHTIPVCKEGIRGHTESCSCPLQQSPRADNSVPGTPTRKISASEFDRPLRPIVVKDSEGTVSFLSDSEKKEQMPLTP |
| Protein accession: | NP_001074 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |
| Publications: | Chronic inflammation promotes myeloid-derived suppressor cell activation blocking antitumor immunity in transgenic mouse melanoma model.Meyer C, Sevko A, Ramacher M, Bazhin AV, Falk CS, Osen W, Borrello I, Kato M, Schadendorf D, Baniyash M, Umansky V. Proc Natl Acad Sci U S A. 2011 Oct 11;108(41):17111-6. Epub 2011 Oct 3. |