Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00008649-M03 |
Product name: | MAPKSP1 monoclonal antibody (M03), clone 2A4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MAPKSP1. |
Clone: | 2A4 |
Isotype: | IgG1 Kappa |
Gene id: | 8649 |
Gene name: | MAPKSP1 |
Gene alias: | MAP2K1IP1|MAPBP|MP1 |
Gene description: | MAPK scaffold protein 1 |
Genbank accession: | NM_021970 |
Immunogen: | MAPKSP1 (NP_068805, 1 a.a. ~ 87 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLP |
Protein accession: | NP_068805 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (35.31 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of MAPKSP1 expression in transfected 293T cell line by MAPKSP1 monoclonal antibody (M03), clone 2A4. Lane 1: MAPKSP1 transfected lysate(13.623 KDa). Lane 2: Non-transfected lysate. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |