MAPKSP1 polyclonal antibody (A01) View larger

MAPKSP1 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MAPKSP1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about MAPKSP1 polyclonal antibody (A01)

Brand: Abnova
Reference: H00008649-A01
Product name: MAPKSP1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant MAPKSP1.
Gene id: 8649
Gene name: MAPKSP1
Gene alias: MAP2K1IP1|MAPBP|MP1
Gene description: MAPK scaffold protein 1
Genbank accession: NM_021970
Immunogen: MAPKSP1 (NP_068805, 1 a.a. ~ 87 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLP
Protein accession: NP_068805
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008649-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.68 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MAPKSP1 polyclonal antibody (A01) now

Add to cart