AKR1C3 MaxPab mouse polyclonal antibody (B02) View larger

AKR1C3 MaxPab mouse polyclonal antibody (B02)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AKR1C3 MaxPab mouse polyclonal antibody (B02)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about AKR1C3 MaxPab mouse polyclonal antibody (B02)

Brand: Abnova
Reference: H00008644-B02
Product name: AKR1C3 MaxPab mouse polyclonal antibody (B02)
Product description: Mouse polyclonal antibody raised against a full-length human AKR1C3 protein.
Gene id: 8644
Gene name: AKR1C3
Gene alias: DD3|DDX|HA1753|HAKRB|HAKRe|HSD17B5|KIAA0119|hluPGFS
Gene description: aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II)
Genbank accession: NM_003739.4
Immunogen: AKR1C3 (NP_003730.4, 1 a.a. ~ 323 a.a) full-length human protein.
Immunogen sequence/protein sequence: MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY
Protein accession: NP_003730.4
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008644-B02-2-A1-1.jpg
Application image note: AKR1C3 MaxPab polyclonal antibody. Western Blot analysis of AKR1C3 expression in human liver.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy AKR1C3 MaxPab mouse polyclonal antibody (B02) now

Add to cart