SCAP1 monoclonal antibody (M01), clone 3D3 View larger

SCAP1 monoclonal antibody (M01), clone 3D3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SCAP1 monoclonal antibody (M01), clone 3D3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,ELISA,WB-Re

More info about SCAP1 monoclonal antibody (M01), clone 3D3

Brand: Abnova
Reference: H00008631-M01
Product name: SCAP1 monoclonal antibody (M01), clone 3D3
Product description: Mouse monoclonal antibody raised against a full length recombinant SCAP1.
Clone: 3D3
Isotype: IgG2a Kappa
Gene id: 8631
Gene name: SKAP1
Gene alias: SCAP1|SKAP55
Gene description: src kinase associated phosphoprotein 1
Genbank accession: BC047870
Immunogen: SCAP1 (AAH47870, 1 a.a. ~ 358 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MQAAALPEEIRWLLEDAEEFLAEGLRNENLSAVARDHRDHILRGFQQIKARYYWDFQPQGGDIGQDSSDDNHSGTLGLSLTSDAPFLSDYQDEGMEDIVKGAQELDNVIKQGYLEKKSKDHSFFGSEWQKRWCVVSRGLFYYYANEKSKQPKGTFLIKGYGVRMAPHLRRDSKKESCFELTSQDRRSYEFTATSPAEARDWVDQISFLLKDLSSLTIPYEEDEEEEEKEETYDDIDGFDSPSCGSQCRPTILPGSVGIKEPTEEKEEEDIYEVLPDEEHDLEEDESGTRRKGDYASYYQGLWDCHGDQPDELSFQRGDLIRILSKEYNMYGWWVGELNSLVGIVPKEYLTTAFEVEER
Protein accession: AAH47870
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008631-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (65.12 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008631-M01-3-5-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to SCAP1 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]
Applications: IHC-P,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SCAP1 monoclonal antibody (M01), clone 3D3 now

Add to cart