HSD17B6 (Human) Recombinant Protein (P01) View larger

HSD17B6 (Human) Recombinant Protein (P01)

H00008630-P01_10ug

New product

199,00 € tax excl.

10 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HSD17B6 (Human) Recombinant Protein (P01)

BrandAbnova
Product typeProteins
Origin speciesHuman
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about HSD17B6 (Human) Recombinant Protein (P01)

Reference: H00008630-P01
Product name: HSD17B6 (Human) Recombinant Protein (P01)
Product description: Human HSD17B6 full-length ORF ( AAH20710, 1 a.a. - 317 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 8630
Gene name: HSD17B6
Gene alias: HSE|RODH|SDR9C6
Gene description: hydroxysteroid (17-beta) dehydrogenase 6 homolog (mouse)
Genbank accession: BC020710
Immunogen sequence/protein sequence: MWLYLAAFVGLYYLLHWYRERQVVSHLQDKYVFITGCDSGFGNLLARQLDARGLRVLAACLTEKGAEQLRGQTSDRLETVTLDVTKMESIAAATQWVKEHVGDRGLWGLVNNAGILTPITLCEWLNTEDSMNMLKVNLIGVIQVTLSMLPLVRRARGRIVNVSSILGRVAFFVGGYCVSKYGVEAFSDILRREIQHFGVKISIVEPGYFRTGMTNMTQSLERMKQSWKEAPKHIKETYGQQYFDALYNIMKEGLLNCSTNLNLVTDCMEHALTSVHPRTRYSAGWDAKFFFIPLSYLPTSLADYILTRSWPKPAQAV
Protein accession: AAH20710
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Shipping condition: Dry Ice

Reviews

Buy HSD17B6 (Human) Recombinant Protein (P01) now

Add to cart