Brand: | Abnova |
Reference: | H00008601-M04 |
Product name: | RGS20 monoclonal antibody (M04), clone 3E10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RGS20. |
Clone: | 3E10 |
Isotype: | IgG2a Kappa |
Gene id: | 8601 |
Gene name: | RGS20 |
Gene alias: | RGSZ1|ZGAP1 |
Gene description: | regulator of G-protein signaling 20 |
Genbank accession: | NM_003702 |
Immunogen: | RGS20 (NP_003693, 78 a.a. ~ 176 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | NQEDQRPTIASHELRADLPTWEESPAPTLEEVNAWAQSFDKLMVTPAGRNAFREFLRTEFSEENMLFWMACEELKKEANKNIIEEKARIIYEDYISILS |
Protein accession: | NP_003693 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: |  |
Application image note: | RGS20 monoclonal antibody (M04), clone 3E10. Western Blot analysis of RGS20 expression in NIH/3T3 ( Cat # L018V1 ). |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |