Brand: | Abnova |
Reference: | H00008600-M33 |
Product name: | TNFSF11 monoclonal antibody (M33), clone 8C1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TNFSF11. |
Clone: | 8C1 |
Isotype: | IgG2b Kappa |
Gene id: | 8600 |
Gene name: | TNFSF11 |
Gene alias: | CD254|ODF|OPGL|OPTB2|RANKL|TRANCE|hRANKL2|sOdf |
Gene description: | tumor necrosis factor (ligand) superfamily, member 11 |
Genbank accession: | BC074890.1 |
Immunogen: | TNFSF11 (AAH74890.1, 158 a.a. ~ 317 a.a) partial recombinant protein. |
Immunogen sequence/protein sequence: | SKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWGKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID |
Protein accession: | AAH74890.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |