Brand: | Abnova |
Reference: | H00008600-M17 |
Product name: | TNFSF11 monoclonal antibody (M17), clone 3F7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TNFSF11. |
Clone: | 3F7 |
Isotype: | IgG2b Kappa |
Gene id: | 8600 |
Gene name: | TNFSF11 |
Gene alias: | CD254|ODF|OPGL|OPTB2|RANKL|TRANCE|hRANKL2|sOdf |
Gene description: | tumor necrosis factor (ligand) superfamily, member 11 |
Genbank accession: | NM_003701 |
Immunogen: | TNFSF11 (NP_003692.1, 222 a.a. ~ 316 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | FRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDI |
Protein accession: | NP_003692.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.19 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged TNFSF11 is 0.1 ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |