TNFSF11 monoclonal antibody (M17), clone 3F7 View larger

TNFSF11 monoclonal antibody (M17), clone 3F7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TNFSF11 monoclonal antibody (M17), clone 3F7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about TNFSF11 monoclonal antibody (M17), clone 3F7

Brand: Abnova
Reference: H00008600-M17
Product name: TNFSF11 monoclonal antibody (M17), clone 3F7
Product description: Mouse monoclonal antibody raised against a partial recombinant TNFSF11.
Clone: 3F7
Isotype: IgG2b Kappa
Gene id: 8600
Gene name: TNFSF11
Gene alias: CD254|ODF|OPGL|OPTB2|RANKL|TRANCE|hRANKL2|sOdf
Gene description: tumor necrosis factor (ligand) superfamily, member 11
Genbank accession: NM_003701
Immunogen: TNFSF11 (NP_003692.1, 222 a.a. ~ 316 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: FRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDI
Protein accession: NP_003692.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008600-M17-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.19 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008600-M17-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged TNFSF11 is 0.1 ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TNFSF11 monoclonal antibody (M17), clone 3F7 now

Add to cart