Cart 152 Product Products 59 398,15 € (empty)
No products
To be determined Shipping
59 398,15 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 152 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 59 398,15 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 59 398,15 €
Data sheet of TNFSF11 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Tr |
More info about TNFSF11 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00008600-D01P |
| Product name: | TNFSF11 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human TNFSF11 protein. |
| Gene id: | 8600 |
| Gene name: | TNFSF11 |
| Gene alias: | CD254|ODF|OPGL|OPTB2|RANKL|TRANCE|hRANKL2|sOdf |
| Gene description: | tumor necrosis factor (ligand) superfamily, member 11 |
| Genbank accession: | NM_033012 |
| Immunogen: | TNFSF11 (ENSP00000351347, 1 a.a. ~ 244 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MDPNRISEDGTHCIYRILRLHENADFQDTTLESQDTKLIPDSCRRIKQAFQGAVQKELQHIVGSQHIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID |
| Protein accession: | ENSP00000351347 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of TNFSF11 expression in transfected 293T cell line (H00008600-T01) by TNFSF11 MaxPab polyclonal antibody. Lane 1: TNFSF11 transfected lysate(27.70 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |