Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of LY6D purified MaxPab mouse polyclonal antibody (B02P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,WB-Tr |
More info about LY6D purified MaxPab mouse polyclonal antibody (B02P)
| Brand: | Abnova |
| Reference: | H00008581-B02P |
| Product name: | LY6D purified MaxPab mouse polyclonal antibody (B02P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human LY6D protein. |
| Gene id: | 8581 |
| Gene name: | LY6D |
| Gene alias: | E48 |
| Gene description: | lymphocyte antigen 6 complex, locus D |
| Genbank accession: | NM_003695.2 |
| Immunogen: | LY6D (NP_003686.1, 1 a.a. ~ 128 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MRTALLLLAALAVATGPALTLRCHVCTSSSNCKHSVVCPASSRFCKTTNTVEPLRGNLVKKDCAESCTPSYTLQGQVSSGTSSTQCCQEDLCNEKLHNAAPTRTALAHSALSLGLALSLLAVILAPSL |
| Protein accession: | NP_003686.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of LY6D expression in transfected 293T cell line (H00008581-T02) by LY6D MaxPab polyclonal antibody. Lane 1: LY6D transfected lysate(14.08 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ce,WB-Tr |
| Shipping condition: | Dry Ice |