TMEFF1 monoclonal antibody (M01), clone 1B1 View larger

TMEFF1 monoclonal antibody (M01), clone 1B1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TMEFF1 monoclonal antibody (M01), clone 1B1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about TMEFF1 monoclonal antibody (M01), clone 1B1

Brand: Abnova
Reference: H00008577-M01
Product name: TMEFF1 monoclonal antibody (M01), clone 1B1
Product description: Mouse monoclonal antibody raised against a partial recombinant TMEFF1.
Clone: 1B1
Isotype: IgG1 Kappa
Gene id: 8577
Gene name: TMEFF1
Gene alias: C9orf2|H7365
Gene description: transmembrane protein with EGF-like and two follistatin-like domains 1
Genbank accession: NM_003692
Immunogen: TMEFF1 (NP_003683, 65 a.a. ~ 172 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SELNVRESDVRVCDESSCKYGGVCKEDGDGLKCACQFQCHTNYIPVCGSNGDTYQNECFLRRAACKHQKEITVIARGPCYSDNGSGSGEGEEEGSGAEVHRKHSKCGP
Protein accession: NP_003683
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008577-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.62 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008577-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged TMEFF1 is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TMEFF1 monoclonal antibody (M01), clone 1B1 now

Add to cart