Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00008576-M03 |
Product name: | STK16 monoclonal antibody (M03), clone 2G6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant STK16. |
Clone: | 2G6 |
Isotype: | IgG2a Kappa |
Gene id: | 8576 |
Gene name: | STK16 |
Gene alias: | FLJ39635|KRCT|MPSK|PKL12|TSF1 |
Gene description: | serine/threonine kinase 16 |
Genbank accession: | NM_001008910 |
Immunogen: | STK16 (NP_001008910, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MGHALCVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDREEAQREADMHRLFNHPNILRLVAYCLRERGAKHEAWLLLPF |
Protein accession: | NP_001008910 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of STK16 expression in transfected 293T cell line by STK16 monoclonal antibody (M03), clone 2G6. Lane 1: STK16 transfected lysate(34.7 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |