Brand: | Abnova |
Reference: | H00008569-M17 |
Product name: | MKNK1 monoclonal antibody (M17), clone 2E5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MKNK1. |
Clone: | 2E5 |
Isotype: | IgG2a Kappa |
Gene id: | 8569 |
Gene name: | MKNK1 |
Gene alias: | MNK1 |
Gene description: | MAP kinase interacting serine/threonine kinase 1 |
Genbank accession: | NM_003684 |
Immunogen: | MKNK1 (NP_003675, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MVSSQKLEKPIEMGSSEPLPIADGDRRRKKKRRGRATDSLPGKFEDMYKLTSELLGEGAYAKVQGAVSLQNGKEYAVKIIEKQAGHSRSRVFREVETLYQ |
Protein accession: | NP_003675 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | |
Application image note: | Immunofluorescence of monoclonal antibody to MKNK1 on HeLa cell . [antibody concentration 10 ug/ml] |
Applications: | IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |