Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PDXK purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,WB-Tr |
More info about PDXK purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00008566-B01P |
| Product name: | PDXK purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human PDXK protein. |
| Gene id: | 8566 |
| Gene name: | PDXK |
| Gene alias: | C21orf124|C21orf97|DKFZp566A071|FLJ31940|FLJ37311|MGC15873|MGC31754|MGC52346|PKH|PNK|PRED79 |
| Gene description: | pyridoxal (pyridoxine, vitamin B6) kinase |
| Genbank accession: | NM_003681.3 |
| Immunogen: | PDXK (NP_003672.1, 1 a.a. ~ 312 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MEEECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNPAGSVVMERIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVL |
| Protein accession: | NP_003672.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of PDXK expression in transfected 293T cell line (H00008566-T01) by PDXK MaxPab polyclonal antibody. Lane 1: PDXK transfected lysate(34.32 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |