Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr,RNAi-Ab |
Brand: | Abnova |
Reference: | H00008562-M01 |
Product name: | DENR monoclonal antibody (M01), clone 1H3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DENR. |
Clone: | 1H3 |
Isotype: | IgG2a Kappa |
Gene id: | 8562 |
Gene name: | DENR |
Gene alias: | DRP|DRP1|SMAP-3 |
Gene description: | density-regulated protein |
Genbank accession: | NM_003677 |
Immunogen: | DENR (NP_003668, 1 a.a. ~ 81 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAADISESSGADCKGDPRNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTVENSPKQEAGIS |
Protein accession: | NP_003668 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | |
Quality control testing picture note: | Western Blot detection against Immunogen (34.65 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | |
Application image note: | Western Blot analysis of DENR expression in transfected 293T cell line by DENR monoclonal antibody (M01), clone 1H3. Lane 1: DENR transfected lysate(22.092 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr,RNAi-Ab |
Shipping condition: | Dry Ice |