DENR purified MaxPab rabbit polyclonal antibody (D01P) View larger

DENR purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DENR purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about DENR purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00008562-D01P
Product name: DENR purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human DENR protein.
Gene id: 8562
Gene name: DENR
Gene alias: DRP|DRP1|SMAP-3
Gene description: density-regulated protein
Genbank accession: NM_003677.3
Immunogen: DENR (NP_003668.2, 1 a.a. ~ 198 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAADISESSGADCKGDPRNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTVENSPKQEAGISEGQGTAGEEEEKKKQKRGGRGQIKQKKKTVPQKVTIAKIPRAKKKYVTRVCGLATFEIDLKEAQRFFAQKFSCGASVTGEDEIIIQGDFTDDIIDVIQEKWPEVDDDSIEDLGEVKK
Protein accession: NP_003668.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00008562-D01P-13-15-1.jpg
Application image note: Western Blot analysis of DENR expression in transfected 293T cell line (H00008562-T01) by DENR MaxPab polyclonal antibody.

Lane 1: DENR transfected lysate(22.10 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy DENR purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart