CDC14A monoclonal antibody (M02), clone 1F11 View larger

CDC14A monoclonal antibody (M02), clone 1F11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CDC14A monoclonal antibody (M02), clone 1F11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA,WB-Re,WB-Tr

More info about CDC14A monoclonal antibody (M02), clone 1F11

Brand: Abnova
Reference: H00008556-M02
Product name: CDC14A monoclonal antibody (M02), clone 1F11
Product description: Mouse monoclonal antibody raised against a partial recombinant CDC14A.
Clone: 1F11
Isotype: IgG2a Kappa
Gene id: 8556
Gene name: CDC14A
Gene alias: cdc14|hCDC14
Gene description: CDC14 cell division cycle 14 homolog A (S. cerevisiae)
Genbank accession: NM_003672
Immunogen: CDC14A (NP_003663, 431 a.a. ~ 530 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PFRLSSSLQGSAVTLKTSKMALSPSATAKRINRTSLSSGATVRSFSINSRLASSLGNLNAATDDPENKKTSSSSKAGFTASPFTNLLNGSSQPTTRNYPE
Protein accession: NP_003663
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008556-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008556-M02-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to CDC14A on HeLa cell. [antibody concentration 10 ug/ml]
Applications: IF,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CDC14A monoclonal antibody (M02), clone 1F11 now

Add to cart