CDC14B purified MaxPab mouse polyclonal antibody (B01P) View larger

CDC14B purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CDC14B purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,WB-Tr

More info about CDC14B purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00008555-B01P
Product name: CDC14B purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human CDC14B protein.
Gene id: 8555
Gene name: CDC14B
Gene alias: CDC14B3|Cdc14B1|Cdc14B2|hCDC14B
Gene description: CDC14 cell division cycle 14 homolog B (S. cerevisiae)
Genbank accession: ENST00000265659
Immunogen: CDC14B (ENSP00000265659, 1 a.a. ~ 471 a.a) full-length human protein.
Immunogen sequence/protein sequence: MKRKSERRSSWAAAPPCSRRCSSTSPGVKKIRSSTQQDPRRRDPQDDVYLDITDRLCFAILYSRPKSASNVHYFSIDNELEYENFYADFGPLNLAMVYRYCCKINKKLKSITMLRKKIVHFTGSDQRKQANAAFLVGCYMVIYLGRTPEEAYRILIFGETSYIPFRDAAYGSCNFYITLLDCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGYHQHSPETYIQYFKNHNVTTIIRLNKRMYDAKRFTDAGFDHHDLFFADGSTPTDAIVKEFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGSVIGPQQQFLVMKQTNLWLEGDYFRQKLKGQENGQHRAAFSKLLSGVDDISINGVENQDQQEPEPYSDDDEINGVTQGDRLRALKSRRQSKTNAIPLTDGWLSQAVTFLDRLLIWLGIHKD
Protein accession: ENSP00000265659
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008555-B01P-13-15-1.jpg
Application image note: Western Blot analysis of CDC14B expression in transfected 293T cell line (H00008555-T01) by CDC14B MaxPab polyclonal antibody.

Lane1:CDC14B transfected lysate(51.81 KDa).
Lane2:Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CDC14B purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart